Recombinant Human TSLP protein (His tag) (denatured) (ab202263)

Overview

  • Product name

    Recombinant Human TSLP protein (His tag) (denatured)
    See all TSLP proteins and peptides
  • Protein length

    Full length protein
  • Description

    Recombinant Human TSLP protein (His tag)

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSYDFTNCDFEKIKAAYLSTISKDLITYM SGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAA LAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPL LKQQ
    • Molecular weight

      17 kDa including tags
    • Amino acids

      29 to 159
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Mature protein without signal peptide. NCBI Accession No.: NP_149024.

Specifications

Our Abpromise guarantee covers the use of ab202263 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 10% Glycerol, 0.32% Tris HCl

General Info

  • Alternative names

    • Thymic stromal lymphopoietin
    • Thymic stromal lymphopoietin protein TSLP
    • Tslp
    • TSLP protein
    • TSLP_HUMAN
    see all
  • Function

    Cytokine that induces the release of T cell-attracting chemokines from monocytes and, in particular, enhances the maturation of CD11c(+) dendritic cells. Can induce allergic inflammation by directly activating mast cells.
  • Tissue specificity

    Expressed in a number of tissues including heart, liver and prostate.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202263 (3 µg)

References

ab202263 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202263.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up