Overview

  • Product name
    Recombinant Human TSPAN3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGQCGITSSKTVLVFLNLIFWGAAGILCYVGAYVFITYDDYDHFFEDVYT LIPAVVIIAVGALLFIIGLIGCCATIRESRCGLATFVIILLLVFVTEVVV VVLGYVYRAKVENEVDRSIQKVYKTYNGTNPDAASRAIDYVQRQLHCCGI HNYSDWENTDWFKETKNQSVPLSCCRETASNCNGSLAHPSDLYAEGCEAL VVKKLQEIMMHVIWAALAFAAIQLLGMLCACIVLCRRSRDPAYELLITGG TYA
    • Amino acids
      1 to 253
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160811 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Tetraspan 3
    • Tetraspan TM4SF
    • tetraspanin 3
    • tetraspanin TM4 A
    • TM4 A
    • TM4A
    • TM4SF8
    • transmembrane 4 superfamily member 8
    • TSPAN 3
    • TSPAN3
    see all
  • Relevance
    TSPAN3 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The use of alternate polyadenylation sites has been found for this gene. Two alternative transcripts encoding different isoforms have been described.
  • Cellular localization
    Membrane

Images

  • ab160811 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160811 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160811.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up