Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEDFLLSNGYQLGKTIGEGTYSKVKEAFSKKHQRKVAIKVIDKMGGPEEF IQRFLPRELQIVRTLDHKNIIQVYEMLESADGKICLVMELAEGGDVFDCV LNGGPLPESR
    • Amino acids
      1 to 110
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164354 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as STK22C.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Serine/threonine protein kinase 22C
    • Serine/threonine-protein kinase 22C
    • Spermiogenesis associated 3
    • SPOGA3
    • STK22C
    • STK22D
    • Testis specific kinase 3
    • Testis specific serine kinase 3
    • Testis specific serine/threonine kinase 22C
    • Testis specific serine/threonine protein kinase 3
    • Testis-specific kinase 3
    • Testis-specific serine/threonine-protein kinase 3
    • TSK 3
    • TSK-3
    • TSK3
    • TSSK-3
    • TSSK3
    • TSSK3_HUMAN
    see all
  • Function
    May be involved in a signaling pathway during male germ cell development or mature sperm function.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylated.
  • Information by UniProt

Images

  • ab164354 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164354 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164354.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up