Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDDAAVLKRRGYLLGINLGEGSYAKVKSAYSERLKFNVAIKIIDRKKAPA DFLEKFLPREIEILAMLNHCSIIKTYEIFETSHGKVYIVMELAVQGDLLE LIKTRGALHEDEARKKFHQLSLAIKYCHDLDVVHRDLKCDNLLLDKDFNI KLSDFSFSKRCLRDDSGRMALSKTFCGSPAYAAPEVLQGIPYQPKVYDIW SLGVILYIMVCGSMPYDDSNIKKMLRIQKEHRVNFPRSKHLTGECKDLIY HMLQPDVNRRLHIDEILSHCWMQPKARGSPSVAINKEGESSRGTEPLWTP EPGSDKKSATKLEPEGEAQPQAQPETKPEGTAMQMSRQSEILGFPSKPST METEEGPPQQPPETRAQ
    • Amino acids
      1 to 367
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164470 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FKSG81
    • serine/threonine kinase 22D (spermiogenesis associated)
    • serine/threonine kinase FKSG81
    • Serine/threonine-protein kinase 22A
    • spermiogenesis associated 4
    • SPOGA1
    • SPOGA4
    • STK22A
    • STK22D
    • Testis specific kinase 1
    • Testis specific serine kinase 1
    • testis specific serine kinase 1B
    • Testis-specific kinase 1
    • Testis-specific serine/threonine-protein kinase 1
    • TSK 1
    • TSK-1
    • TSK1
    • TSSK-1
    • TSSK1_HUMAN
    • Tssk1b
    see all
  • Function
    Testis-specific serine/threonine-protein kinase required during spermatid development. Phosphorylates 'Ser-288' of TSKS. Involved in the late stages of spermatogenesis, during the reconstruction of the cytoplasm. During spermatogenesis, required for the transformation of a ring-shaped structure around the base of the flagellum originating from the chromatoid body.
  • Tissue specificity
    Testis-specific. Present in sperm (at protein level).
  • Sequence similarities
    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylated.
  • Cellular localization
    Cytoplasm. Cytoplasmic vesicle > secretory vesicle > acrosome. Cell projection > cilium > flagellum. In spermatozoa, present in the sperm head and in the flagellum.
  • Information by UniProt

Images

  • ab164470 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164470 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164470.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up