Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSGDKLLSELGYKLGRTIGEGSYSKVKVATSKKYKGTVAIKVVDRRRAPP DFVNKFLPRELSILRGVRHPHIVHVFEFIEVCNGKLYIVMEAAATDLLQA VQRNGRIPGVQARDLFAQIAGAVRYLHDHHLVHRDLKCENVLLSPDERRV KLTDFGFGRQAHGYPDLSTTYCGSAAYASPEVLLGIPYDPKKYDVWSMGV VLYVMVTGCMPFDDSDIAGLPRRQKRGVLYPEGLELSERCKALIAELLQF SPSARPSAGQVARNCWLRAGDSG
    • Molecular weight

      57 kDa including tags
    • Amino acids

      1 to 273
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab204149 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 75 % Densitometry.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 25% Glycerol, 0.002% PMSF, 0.004% DTT, 0.29% Sodium chloride, 0.79% Tris HCl, 0.31% Glutathione, 0.003% EDTA

General Info

  • Alternative names

    • Cancer/testis antigen 72
    • CT72
    • EC 2.7.11.1
    • FKSG82
    • FLJ24002
    • RGD1559764
    • Serine/threonine-protein kinase SSTK
    • Small serine/threonine kinase
    • Small serine/threonine protein kinase
    • SSTK
    • testis-specific serine kinase 6
    • Testis-specific serine/threonine kinase 6
    • Testis-specific serine/threonine-protein kinase 6
    • TSK 6
    • TSSK4
    • TSSK6
    see all
  • Relevance

    TSSK6 is a serine/threonine protein kinase that is required for postmeiotic chromatin remodeling and male fertility. It plays a role in DNA condensation during the postmeiotic chromatin remodeling. TSSK6 has protein kinase activity against myelin basic protein (MBP), as well as autophosphorylation activity. Interacts with the heatshock proteins HSPCB, HSPA8 and HAPA1A. These interactions appear to be required for TSSK6 kinase activity.
  • Cellular localization

    Nuclear

Images

  • SDS-PAGE analysis of ab204149.

References

ab204149 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204149.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up