Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDD IRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQT EPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKS KS
    • Molecular weight

      42 kDa including tags
    • Amino acids

      1 to 152

Specifications

Our Abpromise guarantee covers the use of ab132294 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.

    Previously labelled as TTC11. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 2010003O14Rik
    • CGI 135
    • CGI135
    • FIS 1
    • FIS1
    • Fis1 homolog
    • FIS1, S. cerevisiae, homolog of
    • FIS1_HUMAN
    • Fission 1 (mitochondrial outer membrane) homolog
    • Fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)
    • Fission 1 (mitochondrial outer membrane) homolog (yeast)
    • Fission 1 homolog
    • H NH0132A01.6
    • hFis 1
    • hFis1
    • Mitochondrial fission 1 protein
    • mitochondrial fission molecule
    • Tetratricopeptide repeat domain 11
    • Tetratricopeptide repeat protein 11
    • TPR repeat protein 11
    • TTC 11
    • TTC11
    see all
  • Function

    Promotes the fragmentation of the mitochondrial network and its perinuclear clustering. Can induce cytochrome c release from the mitochondrion to the cytosol, ultimately leading to apoptosis. Also mediates peroxisomal fission.
  • Sequence similarities

    Belongs to the FIS1 family.
    Contains 1 TPR repeat.
  • Domain

    The C-terminus is required for mitochondrial or peroxisomal localization, while the N-terminus is necessary for mitochondrial or peroxisomal fission, localization and regulation of the interaction with DNM1L.
  • Post-translational
    modifications

    Ubiquitinated by MARCH5.
  • Cellular localization

    Mitochondrion outer membrane. Peroxisome membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab132294.

References

ab132294 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132294.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up