Recombinant Human TTC11/FIS1 protein (BSA and azide free) (ab173037)

Description

  • Product name

    Recombinant Human TTC11/FIS1 protein (BSA and azide free)
    See all TTC11/FIS1 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDD IRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQT EPQNNQAKELERLIDKAMKKDGVEHHHHHH
    • Predicted molecular weight

      15 kDa including tags
    • Amino acids

      1 to 122
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Cytoplasmic domain.

Specifications

Our Abpromise guarantee covers the use of ab173037 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Liquid
  • Additional notes

    Previously labelled as TTC11. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.24% Tris

    Supplied as a 0.2 µM filtered solution.

General Info

  • Alternative names

    • 2010003O14Rik
    • CGI 135
    • CGI135
    • FIS 1
    • FIS1
    • Fis1 homolog
    • FIS1, S. cerevisiae, homolog of
    • FIS1_HUMAN
    • Fission 1 (mitochondrial outer membrane) homolog
    • Fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)
    • Fission 1 (mitochondrial outer membrane) homolog (yeast)
    • Fission 1 homolog
    • H NH0132A01.6
    • hFis 1
    • hFis1
    • Mitochondrial fission 1 protein
    • mitochondrial fission molecule
    • Tetratricopeptide repeat domain 11
    • Tetratricopeptide repeat protein 11
    • TPR repeat protein 11
    • TTC 11
    • TTC11
    see all
  • Function

    Promotes the fragmentation of the mitochondrial network and its perinuclear clustering. Can induce cytochrome c release from the mitochondrion to the cytosol, ultimately leading to apoptosis. Also mediates peroxisomal fission.
  • Sequence similarities

    Belongs to the FIS1 family.
    Contains 1 TPR repeat.
  • Domain

    The C-terminus is required for mitochondrial or peroxisomal localization, while the N-terminus is necessary for mitochondrial or peroxisomal fission, localization and regulation of the interaction with DNM1L.
  • Post-translational
    modifications

    Ubiquitinated by MARCH5.
  • Cellular localization

    Mitochondrion outer membrane. Peroxisome membrane.
  • Information by UniProt

References

ab173037 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173037.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up