Description

  • Product name

    Recombinant Human TTYH1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MWLAYVLLLLLELLVCLFTLLGLAKQSKWLVIVMTVMSLLVLVLSWGSMG LEAATAVGLSDFCSNPDPYVLNLTQEETGLSSDILSYYLLCNRAVSNPFQ QRLTLSQRALANIHSQLLGLEREAVPQFPSAQKPLLSLEETLNVTEGNFH QLVALLHCRSLHKDYGAALRGLCEDALEGLLFLLLFSLLSAGALATALCS LPRAWALFPPSDDYDDTDDDDPFNPQQESKRFVQWQSSI
    • Amino acids

      1 to 239
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163539 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • hTTY1
    • hTTYs
    • Protein tweety homolog 1
    • TTYH 1
    • TTYH1
    • TTYH1_HUMAN
    • Tweety 1
    • Tweety homolog 1
    • Tweety homolog 1 (Drosophila)
    • Tweety1
    see all
  • Function

    Probable chloride channel. May be involved in cell adhesion.
    Isoform 3 may be a Ca(2+)-independent and swelling-activated chloride channel, possibly involved in regulation of cell volume.
  • Tissue specificity

    Expressed in brain, eye, ovary and testis, and at lower levels in muscle, placenta, liver and lung.
  • Sequence similarities

    Belongs to the tweety family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab163539 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163539 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163539.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up