Description

  • Product name

    Recombinant Human TUBB4Q protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MRELVLTQTGQCGNQIGAKFWEVISDEHAIDSAGTYHGDSHLQLERINVH HHEASGGRYVSRAVLVDLEPGTMDSVRSGPFGQVFRPDNFISRQCGAGNN WAKGRYTEGAELTESVMDVVRKEAESCDCLQGFQLTHSLGGGTGSGMGTL LISKIWEEYPDRIINTLSILLLPKVSDTVVEPYNATLSVHQLIENADETF CIDNEALYDICSRTLKLPTPTYGDLNHLVSATMSGVTTCLCFPDQLNADL RKLAMNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVAELTQQMFDAKNMM AARDPRHGRYLTAAAIFQGRMPMREVDEQMFNIQDKNSSYFADWFPNNVK TAVCDIPPWGLKMSVTFTGNNTAVQELKRVSEQFTATFRRKAFLHWYTGE GMDEMEFTEAESNMNDLVSEYQQYQDATAEGGGV
    • Amino acids

      1 to 434
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163383 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Putative tubulin beta-4q chain
    • TBB4Q_HUMAN
    • TUB4Q
    • TUBB4Q
    • Tubulin, beta polypeptide 4, member Q
    see all
  • Function

    Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.
  • Sequence similarities

    Belongs to the tubulin family.
  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • ab163383 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163383 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163383.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up