Description

  • Product name

    Recombinant Human TUBD1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSIVTVQLGQCGNQIGFEVFDALLSDSHSSQGLCSMRENEAYQASCKERF FSEEENGVPIARAVLVDMEPKVINQMLSKAAQSGQWKYGQHACFCQKQGS GNNWAYGYSVHGPRHEESIMNIIRKEVEKCDSFSGFFIIMSMAGGTGSGL GAFVTQNLEDQYSNSLKMNQIIWPYGTGEVIVQNYNSILTLSHLYRSSDA LLLHENDAIHKICAKLMNIKQISFSDINQVLAHQLGSVFQPTYSAESSFH YRRNPLGIDRHVWPPLSGLPPLSKMSLNKDLHFNTSIANLVILRGKDVQS ADVEGFKDPALYTSWLKPVNAFNVWKTQRAFSKYEKSAVLVSNSQFLVKP LDMIVGKAWNMFASKAYIHQYTKFGIEEEDFLDSFTSLEQVVASYCNL
    • Amino acids

      1 to 398
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162443 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as Delta 1 Tubulin

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Delta tubulin
    • Delta-tubulin
    • FLJ12709
    • TBD_HUMAN
    • TUBD
    • TUBD1
    • Tubulin delta chain
    see all
  • Function

    In the elongating spermatid it is associated with the manchette, a specialized microtubule system present during reshaping of the sperm head.
  • Sequence similarities

    Belongs to the tubulin family.
  • Cellular localization

    Cytoplasm > cytoskeleton > centrosome > centriole. Cytoplasm. Nucleus. Associated with centrioles. Both cytoplasmic and nuclear.
  • Information by UniProt

Images

  • ab162443 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162443 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162443.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up