Recombinant Human Tubulin Polymerization Promoting Protein (ab161283)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MADKAKPAKAANRTPPKSPGDPSKDRAAKRLSLESEGAGEGAAASPELSA LEEAFRRFAVHGDARATGREMHGKNWSKLCKDCQVIDGRNVTVTDVDIVF SKIKGKSCRTITFEQFQEALEELAKKRFKDKSSEEAVREVHRLIEGKAPI ISGVTKAISSPTVSRLTDTTKFTGSHKERFDPSGKGKGKAGRVDLVDESG YVSGYKHAGTYDQKVQGGK
    • Amino acids
      1 to 219
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161283 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 25 kDa brain specific protein
    • 25 kDa brain-specific protein
    • Brain specific protein p25 alpha
    • Glycogen synthase kinase 3 (GSK3) inhibitor p24
    • OTTHUMP00000161630
    • p24
    • p25
    • p25-alpha
    • p25alpha
    • TPPP
    • TPPP/p25
    • TPPP_HUMAN
    • TPPP1
    • Tubulin polymerization promoting protein
    • Tubulin polymerization-promoting protein
    see all
  • Function
    May play a role in the polymerization of tubulin into microtubules, microtubule bundling and the stabilization of existing microtubules, thus maintaining the integrity of the microtubule network. May play a role in mitotic spindle assembly and nuclear envelope breakdown.
  • Tissue specificity
    Widely expressed.
  • Sequence similarities
    Belongs to the TPPP family.
  • Post-translational
    modifications
    Poor substrate for GSK3 (By similarity). Phosphorylated by LIMK1 on serine residues. Phosphorylation may alter the tubulin polymerization activity.
  • Cellular localization
    Cytoplasm. Cytoplasm, cytoskeleton. Nucleus. Localizes to glial Lewy bodies in the brains of individuals with synucleinopathies.
  • Information by UniProt

Images

  • ab161283 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161283 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161283.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up