Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      PLLCRGLAVEAKKTYVRDKPHVNVGTIGHVDHGKTTLTAATTKILAEGGG AKFKKYEEIDNAPEERARGITINAAHVEYSTAARHYAHTDCPGHADYVKN MITGTAPLDGCILVVAANDGPMPQTREHLLLARQIGVEHVVVYVNKADAV QDSEMVELVELEIRELLTEFGYKGEETPVIVGSALCALEGRDPELGLKSV QKLLDAVDTYIPVPARDLEKPFLLPVEAVYSVPGRGTVVTGTLERGILKK GDECELLGHSKNIRTVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRR GLVMVKPGSIKPHQKVEAQVYILSKEEGGRHKPFVSHFMPVMFSLTWDMA CRIILPPEKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLV TNTLAMTEEEKNIKWG
    • Molecular weight

      72 kDa including tags
    • Amino acids

      37 to 452

Specifications

Our Abpromise guarantee covers the use of ab132756 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • COXPD4
    • EF Tu
    • EF TuMT
    • EF-Tu
    • EF-TuMT
    • EFTu
    • EFTU_HUMAN
    • EFTuMT
    • Elongation factor Tu
    • Elongation factor Tu mitochondrial
    • mitochondrial
    • P43
    • Tu translation elongation factor, mitochondrial
    • Tufm
    see all
  • Function

    This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis.
  • Involvement in disease

    Combined oxidative phosphorylation deficiency 4 (COXPD4) [MIM:610678]: A mitochondrial disease resulting in neonatal lactic acidosis, rapidly progressive encephalopathy, severely decreased mitochondrial protein synthesis, and combined deficiency of mtDNA-related mitochondrial respiratory chain complexes. Note=The disease is caused by mutations affecting the gene represented in this entry.
  • Sequence similarities

    Belongs to the GTP-binding elongation factor family. EF-Tu/EF-1A subfamily.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt

Images

  • ab132756 by 12.5% SDS-PAGE stained with Coomassie blue.

References

ab132756 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132756.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up