Overview

  • Product name

    Recombinant Human TUFM protein (His tag)
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      AVEAKKTYVRDKPHVNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYE EIDNAPEERARGITINAAHVEYSTAARHYAHTDCPGHADYVKNMITGTAP LDGCILVVAANDGPMPQTREHLLLARQIGVEHVVVYVNKADAVQDSEMVE LVELEIRELLTEFGYKGEETPVIVGSALCALEGRDPELGLKSVQKLLDAV DTYIPVPARDLEKPFLLPVEAVYSVPGRGTVVTGTLERGILKKGDECELL GHSKNIRTVVTGIEMFHKSLERAEAGDNLGALVRGLKREDLRRGLVMVKP GSIKPHQKVEAQVYILSKEEGGRHKPFVSHFMPVMFSLTWDMACRIILPP EKELAMPGEDLKFNLILRQPMILEKGQRFTLRDGNRTIGTGLVTNTLAMT EEEKNIKWG
    • Molecular weight

      49 kDa including tags
    • Amino acids

      44 to 452
    • Tags

      His tag N-Terminus
    • Additional sequence information

      N-terminal 6xHis-tagged. Full length mature chain without transit peptide.

Specifications

Our Abpromise guarantee covers the use of ab236184 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • COXPD4
    • EF Tu
    • EF TuMT
    • EF-Tu
    • EF-TuMT
    • EFTu
    • EFTU_HUMAN
    • EFTuMT
    • Elongation factor Tu
    • Elongation factor Tu mitochondrial
    • mitochondrial
    • P43
    • Tu translation elongation factor, mitochondrial
    • Tufm
    see all
  • Function

    This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis.
  • Involvement in disease

    Combined oxidative phosphorylation deficiency 4 (COXPD4) [MIM:610678]: A mitochondrial disease resulting in neonatal lactic acidosis, rapidly progressive encephalopathy, severely decreased mitochondrial protein synthesis, and combined deficiency of mtDNA-related mitochondrial respiratory chain complexes. Note=The disease is caused by mutations affecting the gene represented in this entry.
  • Sequence similarities

    Belongs to the GTP-binding elongation factor family. EF-Tu/EF-1A subfamily.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel analysis of ab236184.

References

ab236184 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236184.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up