Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      ALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLR RVHKNLIPQGIVKLDHPRIHVDFPVILYEV
    • Amino acids

      31 to 110
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161417 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as TUSC2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C3orf11
    • Fus-1 protein
    • FUS1
    • Fusion 1 protein
    • LGCC
    • PAP
    • PDAP2
    • PDGFA associated protein 2
    • PDGFA-associated protein 2
    • Tumor suppressor candidate 2
    • TUSC 2
    • Tusc2
    • TUSC2_HUMAN
    see all
  • Function

    May function as a tumor suppressor, inhibiting colony formation, causing G1 arrest and ultimately inducing apoptosis in homozygous 3p21.3 120-kb region-deficient cells.
  • Tissue specificity

    Strong expression in heart, lung, skeletal muscle, kidney, and pancreas, followed by brain and liver, lowest levels in placenta.
  • Sequence similarities

    Belongs to the TUSC2 family.
  • Post-translational
    modifications

    Myristoylation is required for tumor suppressor activity.
  • Information by UniProt

Images

  • ab161417 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161417 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161417.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up