Description

  • Product name

    Recombinant human TWEAKR/FN14 protein
    See all TWEAKR/FN14 proteins and peptides
  • Biological activity

    Fully biologically active when compared to standard.

    The ED50 as determined by inhibiting TWEAK-dependent proliferation of Human umbilical vein endothelial cells (HUVEC) is less than 30 ng/ml, corresponding to a specific activity of > 3.3 × 104 IU/mg, in the presence of 15 ng/ml of TWEAKR.

  • Purity

    > 95 % SDS-PAGE.
    > 95 % by HPLC.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRL LWP
    • Predicted molecular weight

      6 kDa
    • Amino acids

      28 to 80

Specifications

Our Abpromise guarantee covers the use of ab201431 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

    HPLC

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as TWEAKR

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    0.2µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Briefly centrifuge prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at <-20°C. Further dilutions should be made in appropriate buffered solutions.

General Info

  • Alternative names

    • CD 266
    • CD266
    • CD266 antigen
    • FGF inducible 14
    • FGF-inducible 14
    • Fibroblast growth factor inducible immediate early response protein 14
    • Fibroblast growth factor-inducible immediate-early response protein 14
    • FN 14
    • FN14
    • TNFRSF 12A
    • TNFRSF12A
    • TNR12_HUMAN
    • Tumor necrosis factor receptor superfamily member 12A
    • TWEAK R
    • Tweak receptor
    • Tweak-receptor
    • TweakR
    see all
  • Function

    Receptor for TNFSF12/TWEAK. Weak inducer of apoptosis in some cell types. Promotes angiogenesis and the proliferation of endothelial cells. May modulate cellular adhesion to matrix proteins.
  • Tissue specificity

    Highly expressed in heart, placenta and kidney. Intermediate expression in lung, skeletal muscle and pancreas.
  • Sequence similarities

    Contains 1 TNFR-Cys repeat.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab201431 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab201431.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up