Recombinant Human TWEAKR/FN14 protein (Fc Chimera His Tag) (ab223000)

Description

  • Product name

    Recombinant Human TWEAKR/FN14 protein (Fc Chimera His Tag)
    See all TWEAKR/FN14 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    Purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRL LWPLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQ DWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKN QVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLT VDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
    • Predicted molecular weight

      33 kDa including tags
    • Amino acids

      28 to 80
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This construct corresponds to the extracellular domain lacking the N-terminal signal peptide (aa 1-27). The full C-terminal tag is hlgG-His.

Specifications

Our Abpromise guarantee covers the use of ab223000 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as TWEAKR

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 0.02% DTT, 20% Glycerol, PBS

General Info

  • Alternative names

    • CD 266
    • CD266
    • CD266 antigen
    • FGF inducible 14
    • FGF-inducible 14
    • Fibroblast growth factor inducible immediate early response protein 14
    • Fibroblast growth factor-inducible immediate-early response protein 14
    • FN 14
    • FN14
    • TNFRSF 12A
    • TNFRSF12A
    • TNR12_HUMAN
    • Tumor necrosis factor receptor superfamily member 12A
    • TWEAK R
    • Tweak receptor
    • Tweak-receptor
    • TweakR
    see all
  • Function

    Receptor for TNFSF12/TWEAK. Weak inducer of apoptosis in some cell types. Promotes angiogenesis and the proliferation of endothelial cells. May modulate cellular adhesion to matrix proteins.
  • Tissue specificity

    Highly expressed in heart, placenta and kidney. Intermediate expression in lung, skeletal muscle and pancreas.
  • Sequence similarities

    Contains 1 TNFR-Cys repeat.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab223000 (3μg) was analysed by 15% SDS-PAGE.

References

ab223000 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223000.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up