Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      FAGYQKHLSSCAAPAPLTSAERELQQIRINEVKTEISVESKHQTLQGLAF PLQPEAQRALQQLKQKMVNYIQMKLDLERETIELVHTEPTDVAQLPSRVP
    • Amino acids
      131 to 230
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161424 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • A6 related protein
    • A6-related protein
    • A6r
    • A6RP
    • hA6RP
    • MSTP011
    • Protein tyrosine kinase 9 like
    • Protein tyrosine kinase 9-like
    • PTK 9L
    • PTK9L
    • PTK9L protein tyrosine kinase 9 like
    • TWF 2
    • Twf2
    • TWF2_HUMAN
    • Twinfilin 1 like protein
    • Twinfilin 2
    • Twinfilin actin binding protein homolog 2
    • Twinfilin like protein
    • Twinfilin-1-like protein
    • Twinfilin-2
    • Twinfilin2
    see all
  • Function
    Actin-binding protein involved in motile and morphological processes. Inhibits actin polymerization, likely by sequestering G-actin. By capping the barbed ends of filaments, it also regulates motility. Seems to play an important role in clathrin-mediated endocytosis and distribution of endocytic organelles. May play a role in regulating the mature length of the middle and short rows of stereocilia.
  • Tissue specificity
    Ubiquitously expressed (at protein level).
  • Sequence similarities
    Belongs to the actin-binding proteins ADF family. Twinfilin subfamily.
    Contains 2 ADF-H domains.
  • Post-translational
    modifications
    In vitro, phosphorylated by PRKCZ, CK2 and SRC.
  • Cellular localization
    Cytoplasm > cytoskeleton. Cytoplasm > perinuclear region. Cell projection > stereocilium. Perinuclear and G-actin-rich cortical actin structure sublocalization.
  • Information by UniProt

Images

  • ab161424 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161424 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161424.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up