Description

  • Product name

    Recombinant Human TXNDC15 protein
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      VEVAEESGRLWSEEQPAHPLQVGAVYLGEEELLHDPMGQDRAAEEANAVL GLDTQGDHMVMLSVIPGEAEDKVSSEPSGVTCGAGGAEDSRCNVRESLFS LDGAGAHFPDREEEYYTEPEVAESDAAPTEDSNNTESLKSPKVNCEERNI TGLENFTLKILNMSQDLMDFLNPNGSDCTLVLFYTPWCRFSASLAPHFNS LPRAFPALHFLALDASQHSSLSTRFGTVAVPNILLFQGAKPMARFNHTDR TLETLKIFIFNQTGIEAKKNVVVTQADQIGPLPSTLIKSVDHHHHHH
    • Predicted molecular weight

      33 kDa including tags
    • Amino acids

      33 to 321
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab194018 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    pH: 7.40
    Constituents: 0.87% Sodium chloride, 99% Phosphate Buffer

  • Reconstitution
    Reconstituted protein solution can be stored at 4-7 deg.C for 2-7 days. Aliquots of reconstituted samples are stable at < -20 deg.C for 3 months.

General Info

  • Alternative names

    • 2310047H23Rik
    • AI854086
    • C5orf14
    • Disulfide isomerase
    • FLJ22625
    • MGC109343
    • OTTHUMP00000223117
    • RGD1304696
    • Thioredoxin domain containing 15
    • Thioredoxin domain-containing protein 15
    • TXD15_HUMAN
    • Txndc15
    • UNQ335
    • UNQ335/PRO534
    see all
  • Sequence similarities

    Contains 1 thioredoxin domain.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab194018 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab194018.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up