Description

  • Product name

    Recombinant Human TXNDC3 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASKKREVQLQTVINNQSLWDEMLQNKGLTVIDVYQAWCGPCRAMQPLFR KLKNELNEDEILHFAVAEADNIVTLQPFRDKCEPVFLFSVNGKIIEKIQG ANAPLVNKKVINLIDEERKIAAGEMARPQYPEIPLVDSDSEVSEESPCES VQELYSIAIIKPDAVISKKVLEIKRKITKAGFIIEAEHKTVLTEEQVVNF YSRIADQRDFEEFVSFMTSGLSYILVVSQGSKHNPPSEETEPQTDTEPNE RSEDQPEVEAQVTPGMMKNKQDSLQEYLERQHLAQLCDIEEDAANVAKFM DAFFPDFKKMKSMKLEKTLALLRPNLFHERKDDVLRIIKDEDFKILEQRQ VVLSEKEAQALCKEYENEDYFNKLIENMTSGPSLALVLLRDNGLQYWKQL LGPRTVEEAIEYFPESLCAQFAMDSLPVNQLYGSDSLETAEREIQHFFPL QSTLGLIKPHATSEQREQILKIVKEAGFDLTQVKKMFLTPEQTEKIYPKV TGKDFYKDLLEMLSVGPSMVMILTKWNAVAEWRRLMGPTDPEEAKLLSPD SIRAQFGISKLKNIVHGASNAYEAKEVVNRLFEDPEEN
    • Amino acids

      1 to 588
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162505 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CILD6
    • NM23 H8
    • NME8
    • Sperm specific thioredoxin 2
    • Spermatid specific thioredoxin 2
    • Sptrx 2
    • SPTRX2
    • Thioredoxin domain containing protein 3
    see all
  • Relevance

    Probably required during the final stages of sperm tail maturation in the testis and/or epididymis, where extensive disulfide bonding of fibrous sheath (FS) proteins occurs. May be involved in the reduction of disulfide bonds within the sperm FS components. In vitro, it has neither NDP kinase nor reducing activity on disulfide bonds. TXNDC3 encodes a group II thioredoxin protein, composed of a thioredoxin domain and three NDP kinase domains, with testis specific expression.
  • Cellular localization

    Cytoplasm

Images

  • ab162505 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162505 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162505.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up