Overview

  • Product name

    Recombinant Human TXNDC5 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MTQSVDSNRGNRNEKRCGHCQRLQPTWNDLGDKYNSMEDAKVYVAKVDCT AHSDVCSAQGVRGYPTLKLFKPGQEAVKYQGPRDFQTLENWMLQTLNEEP VTPEPEVEPPSAPELKQGLYELSASNFELHVAQGDHFIKFFAPWCGHCKA LAPTWEQLALGLEHSETVKIGKVDCTQHYELCSGNQVRGYPTLLWFRDGK KVDQYKGKRDLESLREYVESQLQRTETGATETVTPSEAPVLAAEPEADKG TVLALTENNFDDTIAEGITFIKFYAPWCGHCKTLAPTWEELSKKEFPGLA GVKIAEVDCTAERNICSKYSVRGYPTLLLFRGGKKVSEHSGGRDLDSLHR FVLSQAKDEL
    • Molecular weight

      67 kDa including tags
    • Amino acids

      89 to 432

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132124 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • EndoPDI
    • Endoplasmic reticulum protein ERp46
    • Endoplasmic reticulum resident protein 46
    • Endothelial protein disulphide isomerase
    • ER protein 46
    • ERp46
    • Hcc 2
    • MGC3178
    • PDIA15
    • Protein disulfide isomerase family A member 15
    • STRF8
    • Thioredoxin domain containing 5
    • Thioredoxin domain containing 5 (endoplasmic reticulum)
    • Thioredoxin domain containing protein 5
    • Thioredoxin domain-containing protein 5
    • Thioredoxin like protein p46
    • Thioredoxin related protein
    • Thioredoxin-like protein p46
    • TLP46
    • TXND5_HUMAN
    • TXNDC 5
    • Txndc5
    see all
  • Function

    Possesses thioredoxin activity. Has been shown to reduce insulin disulfide bonds. Also complements protein disulfide-isomerase deficiency in yeast.
  • Sequence similarities

    Belongs to the protein disulfide isomerase family.
    Contains 3 thioredoxin domains.
  • Cellular localization

    Endoplasmic reticulum lumen.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132124, stained with Coomassie Blue.

References

ab132124 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132124.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up