Description

  • Product name

    Recombinant Human TXNRD1 protein
    See all TXNRD1 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    refolded and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHENLYFQGGEFNGPEDLPKSYDYDLIIIGGGS GGLAAAKEAAQYGK KVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLM HQAALLGQALQDSRNYGWKVEETVKHDWDR MIEAVQNHIGSLNWGYRV ALREKKVVYENAYGQFIGPHRIKATNNKGKEKIYSAERFLIATGER PR YLGIPGDKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDV TVMVRSILLRGF DQDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTP GRLRVVAQSTNSEEIIEGEYNTVMLAIG RDACTRKIGLETVGVKINEK TGKIPVTDEEQTNVPYIYAIGDILEDKVELTPVAIQAGRLLAQR LYAG STVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPLE WTIPSRDNNK CYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKC GLTKKQLDSTIGIHPVCAEVFTTLSV TKRSGASILQAGCUG
    • Predicted molecular weight

      58 kDa including tags
    • Amino acids

      2 to 499
    • Additional sequence information

      Isoform 5 with 29 aa N-terminal T7 / His / TEV cleavage site Tags.

Specifications

Our Abpromise guarantee covers the use of ab204206 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituent: 0.32% Tris HCl

    Contains NaCl, KCl, EDTA, Sucrose, and DTT

General Info

  • Alternative names

    • cytoplasmic
    • Gene associated with retinoic and IFN-induced mortality 12 protein
    • Gene associated with retinoic and interferon-induced mortality 12 protein
    • Gene associated with retinoid IFN induced mortality 12 protein
    • GRIM 12
    • GRIM-12
    • GRIM12
    • KDRF
    • KM 102 derived reductase like factor
    • KM-102-derived reductase-like factor
    • MGC9145
    • Oxidoreductase
    • Thioredoxin reductase 1
    • Thioredoxin reductase 1 cytoplasmic
    • Thioredoxin reductase GRIM 12
    • Thioredoxin reductase TR1
    • TR
    • TR 1
    • TR1
    • TRXR 1
    • TRXR1
    • TRXR1_HUMAN
    • TXNR
    • TXNRD 1
    • Txnrd1
    see all
  • Function

    Isoform 1 may possess glutaredoxin activity as well as thioredoxin reductase activity and induces actin and tubulin polymerization, leading to formation of cell membrane protrusions. Isoform 4 enhances the transcriptional activity of estrogen receptors alpha and beta while isoform 5 enhances the transcriptional activity of the beta receptor only. Isoform 5 also mediates cell death induced by a combination of interferon-beta and retinoic acid.
  • Tissue specificity

    Isoform 1 is expressed predominantly in Leydig cells (at protein level). Also expressed in ovary, spleen, heart, liver, kidney and pancreas and in a number of cancer cell lines. Isoform 4 is widely expressed with highest levels in kidney, testis, uterus, ovary, prostate, placenta and fetal liver.
  • Sequence similarities

    Belongs to the class-I pyridine nucleotide-disulfide oxidoreductase family.
    Contains 1 glutaredoxin domain.
  • Domain

    The N-terminal glutaredoxin domain found in isoform 1 does not contain the C-P-Y-C redox-active motif normally found in glutaredoxins and has been found to be inactive in classical glutaredoxin assays.
  • Post-translational
    modifications

    The N-terminus of isoform 5 is blocked.
    ISGylated.
  • Cellular localization

    Cytoplasm and Cytoplasm. Nucleus.
  • Information by UniProt

References

ab204206 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204206.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up