Description

  • Product name

    Recombinant Human Tyrosyl tRNA synthetase/TyrRS protein (Tagged)
    See all Tyrosyl tRNA synthetase/TyrRS proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    The final product was refolded using unique “temperature shift inclusion body refolding” technology and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHENLYFQGGEFGDAPSPEEKLHLITRNLQEVL GEEKLKEILKERELKIYWGTATTGKPHVAYFVPMSKIADFLKAGCEVTIL FADLHAYLDNMKAPWELLELRVSYYENVIKAMLESIGVPLEKLKFIKGTD YQLSKEYTLDVYRLSSVVTQHDSKKAGAEVVKQVEHPLLSGLLYPGLQAL DEEYLKVDAQFGGIDQRKIFTFAEKYLPALGYSKRVHLMNPMVPGLTGSK MSSSEEESKIDLLDRKEDVKKKLKKAFCEPGNVENNGVLSFIKHVLFPLK SEFVILRDEKWGGNKTYTAYVDLEKDFAAEVVHPGDLKNSVEVALNKLLD PIREKFNTPALKKLASAAYPDPSKQKPMAKGPAKNSEPEEVIPSRLDIRV GKIITVEKHPDADSLYVEKIDVGEAEPRTVVSGLVQFVPKEELQDRLVVV LCNLKPQKMRGVESQGMLLCASIEGINRQVEPLDPPAGSAPGEHVFVKGY EKGQPDEELKPKKKVFEKLQADFKISEECIAQWKQTNFMTKLGSISCKSL KGGNIS
    • Predicted molecular weight

      62 kDa including tags
    • Amino acids

      2 to 528
    • Tags

      His-T7 tag N-Terminus
    • Additional sequence information

      Constructed with codon optimization and expressed with a small T7-His-TEV cleavage site Tag (29aa) fusion at its N-terminal. NP_003671.1.

Specifications

Our Abpromise guarantee covers the use of ab190402 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Previously labelled as Tyrosyl tRNA synthetase

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 0.32% Tris HCl

    Contains NACl, EDTA, KCl, arginine, DTT and glycerol

General Info

  • Alternative names

    • CMTDIC
    • SYYC_HUMAN
    • Tyrosine tRNA ligase, cytoplasmic
    • Tyrosine tRNA ligase 1, cytoplasmic
    • Tyrosyl tRNA synthetase
    • Tyrosyl--tRNA ligase
    • Tyrosyl-tRNA synthetase, cytoplasmic
    • TyrRS
    • yars
    • YRS
    • YTS
    see all
  • Function

    Catalyzes the attachment of tyrosine to tRNA(Tyr) in a two-step reaction: tyrosine is first activated by ATP to form Tyr-AMP and then transferred to the acceptor end of tRNA(Tyr).
  • Involvement in disease

    Defects in YARS are the cause of Charcot-Marie-Tooth disease dominant intermediate type C (CMTDIC) [MIM:608323]. CMTDIC is a form of Charcot-Marie-Tooth disease characterized by clinical and pathologic features intermediate between demyelinating and axonal peripheral neuropathies, and motor median nerve conduction velocities ranging from 25 to 45 m/sec.
  • Sequence similarities

    Belongs to the class-I aminoacyl-tRNA synthetase family.
    Contains 1 tRNA-binding domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

References

ab190402 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab190402.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up