Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSLPPIRLPSPYGSDRLVQLAARLRPALCDTLITVGSQEFPAHSLVLAGV SQQLGRRGQWALGEGISPSTFAQLLNFVYGESVELQPGELRPLQEAARAL GVQSLEEACWRARGDRAKKPDPGLKKHQEEPEKPSRNPERELGDPGEKQK PKQVSRTGGREQEMLHKHSPPRGRPEMAGATQEAQQEQTRSKEKRLQAPV GQRGADGKHGVLTWLRENPGGSEESLRKLPGPLPPAGSLQTSVTPRPSWA EAPWLVGGQPALWSILLMPPRYGIPFYHSTPTTGAWQEVWREQRRTCNLC GS
    • Amino acids
      1 to 302
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162059 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FANCC interacting protein
    • FANCC-interacting protein
    • Fanconi anemia zinc finger protein
    • FAXF
    • FAZF
    • OTTHUMP00000045790
    • repressor of GATA
    • Rog
    • Testis zinc finger protein
    • ZBT32_HUMAN
    • Zbtb32
    • ZBTB32 protein
    • Zinc finger and BTB domain containing 32
    • Zinc finger and BTB domain-containing protein 32
    • Zinc finger protein 538
    • ZNF538
    see all
  • Function
    DNA-binding protein that binds to the to a 5'-TGTACAGTGT-3' core sequence. May function as a transcriptional transactivator and transcriptional repressor. Probably exerts its repressor effect by preventing GATA3 from binding to DNA. May play a role in regulating the differentiation and activation of helper T cells.
  • Tissue specificity
    Predominantly expressed in testis. Some isoforms are ubiquitously expressed.
  • Sequence similarities
    Belongs to the krueppel C2H2-type zinc-finger protein family.
    Contains 1 BTB (POZ) domain.
    Contains 3 C2H2-type zinc fingers.
  • Domain
    The C-terminal zinc finger domain functions as a transcriptional transactivator.
    The BTB (POZ) domain possesses repressor activity.
  • Cellular localization
    Nucleus. Located in nuclear speckles.
  • Information by UniProt

Images

  • ab162059 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162059 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162059.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up