Description

  • Product name

    Recombinant Human U1-C protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLI DKTTAAFQQGKIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGP PMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPMMVPT RPGMTRPDR
    • Predicted molecular weight

      44 kDa including tags
    • Amino acids

      1 to 159

Specifications

Our Abpromise guarantee covers the use of ab117010 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ20302
    • OTTHUMP00000016238
    • OTTMUSP00000026897
    • RU1C_HUMAN
    • Small nuclear ribonucleoprotein polypeptide C
    • Snrpc
    • U1 C
    • U1 small nuclear ribonucleoprotein 1C
    • U1 small nuclear ribonucleoprotein C
    • U1 small nuclear RNP specific C
    • U1 snRNP C
    • U1 snRNP protein C
    • U1-C
    • U1C
    • U1C protein
    • Yhc1
    see all
  • Function

    This protein is associated with snRNP U1.
  • Sequence similarities

    Belongs to the U1 small nuclear ribonucleoprotein C family.
    Contains 1 matrin-type zinc finger.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab117010 at approximately 43.56 kDa.
    Stained with Coomassie Blue.

References

ab117010 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117010.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up