Description

  • Product name

    Recombinant Human U1SNRNPBP protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MKPANMNDWMPIAKEYDPLKAGSIDGTDEDPHDRAVWRAMLARYVPNKGV IGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIRRLRLVRDLVTGFSKGYA FIEYKEERAVIKAYRDADGLVIDQHEIFVDYELERTLKGWIPRRLGGGLG GKKESGQLRFGGRDRPFRKPINLPVVKNDLYREGKRERRERSRSRERHWD SRTRDRDHDRGREKRWQEREPTRVWPDNDWERERDFRDDRIKGREKKERG K
    • Amino acids

      1 to 251
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161277 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • HM 1
    • Small nuclear ribonucleoprotein U11/U12 subunit 35
    • SNRNP35
    • U1 snRNP binding protein homolog
    • U11/U12 snRNP
    • U11/U12 snRNP 35K
    • U11/U12 snRNP 35K, isoform b
    see all
  • Relevance

    U1SNRNPBP is a homolog of U1-snRNP binding protein. Its N-terminal contains an RNA recognition motif. The C-terminal is rich in Arg/Asp and Arg/Glu dipeptides, commonly found in splicing factors. Exists in at least two isoforms produced by alternative splicing that differ in the 5' sequence regions.
  • Cellular localization

    Nuclear

Images

  • ab161277 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161277 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161277.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up