Overview

  • Product name

    Recombinant Human U2AF65 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      GSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQAPGNPVLAVQ INQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSE
    • Amino acids

      141 to 240
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153184 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • hU2AF(65)
    • hU2AF65
    • Splicing factor U2AF 65 kDa subunit
    • U2 (RNU2) small nuclear RNA auxiliary factor 2
    • U2 auxiliary factor 65 kDa subunit
    • U2 small nuclear ribonucleoprotein auxiliary factor (65kD)
    • U2 small nuclear RNA auxiliary factor 2
    • U2 snRNP auxiliary factor large subunit
    • U2af2
    • U2AF2_HUMAN
    • U2AF65
    see all
  • Function

    Necessary for the splicing of pre-mRNA. Induces cardiac troponin-T (TNNT2) pre-mRNA exon inclusion in muscle. Regulates the TNNT2 exon 5 inclusion through competition with MBNL1. Binds preferentially to a single-stranded structure within the polypyrimidine tract of TNNT2 intron 4 during spliceosome assembly. Required for the export of mRNA out of the nucleus, even if the mRNA is encoded by an intron-less gene. Represses the splicing of MAPT/Tau exon 10.
  • Sequence similarities

    Belongs to the splicing factor SR family.
    Contains 3 RRM (RNA recognition motif) domains.
  • Post-translational
    modifications

    Lysyl-hydroxylation at Lys-15 and Lys-276 affects the mRNA splicing activity of the protein, leading to regulate some, but not all, alternative splicing events.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab153184 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153184 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153184.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up