Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MNINDLKLTLSKAGQEHLLRFWNELEEAQQVELYAELQAMNFEELNFFFQ KAIEGFNQSSYQKNVDARMEPVPREVLGSATRDQDQLQAWESEGLFQISQ NKVAVLLLAGGQGTRLGVAYPKGMYDVGLPSRKTLFQIQAERILKLQQVA EKYYGNKCIIPWYIMTSGRTMESTKEFFTKHKYFGLKKENVIFFQQGMLP AMSFDGKIILEEKNKVSMAPDGNGGLYRALAAQNIVEDMEQRGIWSIHVY CVDNILVKVADPRFIGFCIQKGADCGAKVVEKTNPTEPVGVVCRVDGVYQ VVEYSEISLATAQKRSSDGRLLFNAGNIANHFFTVPFLRDVVNVYEPQLQ HHVAQKKIPYVDTQGQLIKPDKPNGIKMEKFVFDIFQFAKKFVVYEVLRE DEFSPLKNADSQNGKDNPTTARHALMSLHHCWVLNAGGHFIDENGSRLPA IPRLKDANDVPIQCEISPLISYAGEGLESYVADKEFHAPLIIDENGVHEL VKNGI
    • Amino acids

      1 to 505
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159565 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AGX
    • AGX 1
    • AGX-1
    • AGX-2
    • AGX1
    • Antigen X
    • AntigenX
    • SPAG 2
    • SPAG2
    • Sperm associated antigen 2
    • Sperm-associated antigen 2
    • UAP 1
    • uap1
    • UAP1_HUMAN
    • UDP N acetylhexosamine pyrophosphorylase
    • UDP N acteylglucosamine pyrophosphorylase 1
    • UDP-N-acetylglucosamine pyrophosphorylase
    see all
  • Function

    Converts UDP and GlcNAc-1-P into UDP-GlcNAc, and UDP and GalNAc-1-P into UDP-GalNAc. Isoform AGX1 has 2 to 3 times higher activity towards GalNAc-1-P, while isoform AGX2 has 8 times more activity towards GlcNAc-1-P.
  • Tissue specificity

    Widely expressed. Isoform AGX1 is more abundant in testis than isoform AGX2, while isoform AGX2 is more abundant than isoform AGX1 in somatic tissue. Expressed at low level in placenta, muscle and liver.
  • Pathway

    Nucleotide-sugar biosynthesis; UDP-N-acetyl-alpha-D-glucosamine biosynthesis; UDP-N-acetyl-alpha-D-glucosamine from N-acetyl-alpha-D-glucosamine 1-phosphate: step 1/1.
  • Sequence similarities

    Belongs to the UDPGP type 1 family.
  • Cellular localization

    Cytoplasm. In spermatozoa, localized to the principal piece of the tail, the neck region of the head and to a lesser extent, the midpiece of the tail.
  • Information by UniProt

Images

  • ab159565 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159565 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159565.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up