Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MADGEEPEKKRRRIEELLAEKMAVDGGCGDTGDWEGRWNHVKKFLERSGP FTHPDFEPSTESLQFLLDTCKVLVIGAGGLGCELLKNLALSGFRQIHVID MDTIDVSNLNRQFLFRPKDIGRPKAEVAAEFLNDRVPNCNVVPHFNKIQD FNDTFYRQFHIIVCGLDSIIARRWINGMLISLLNYEDGVLDPSSIVPLID GGTEGFKGNARVILPGMTACIECTLELYPPQVNFPMCTIASMPRLPEHCI EYVRMLQWPKEQPFGEGVPLDGDDPEHIQWIFQKSLERASQYNIRGVTYR LTQGVVKRIIPAVASTNAVIAAVCATEVFKIATSAYIPLNNYLVFNDVDG LYTYTFEAERKENCPACSQLPQNIQFSPSAKLQEVLDYLTNSASLQMKSP AITATLEGKNRTLYLQSVTSIEERTRPNLSKTLKELGLVDGQELAVADVT TPQTVLFKLHFTS
    • Molecular weight

      73 kDa including tags
    • Amino acids

      1 to 463

Associated products

Specifications

Our Abpromise guarantee covers the use of ab140421 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Purity

    > 95 % Densitometry.

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as UBE1C

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.31% Glutathione, 0.002% PMSF, 0.004% DTT, 0.79% Tris HCl, 0.003% EDTA, 25% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • DKFZp566J164
    • EC 6.3.2.
    • hUba3
    • MGC22384
    • NEDD8 activating enzyme E1 catalytic subunit
    • NEDD8 activating enzyme E1C
    • Nedd8 activating enzyme hUba3
    • NEDD8-activating enzyme E1 catalytic subunit
    • NEDD8-activating enzyme E1C
    • uba3
    • UBA3 ubiquitin activating enzyme E1 homolog
    • UBA3_HUMAN
    • UBE1C
    • Ubiquitin activating enzyme 3
    • Ubiquitin activating enzyme E1C
    • Ubiquitin-activating enzyme 3
    • Ubiquitin-activating enzyme E1C
    • Ubiquitin-like modifier-activating enzyme 3
    see all
  • Function

    Catalytic subunit of the dimeric UBA3-NAE1 E1 enzyme. E1 activates NEDD8 by first adenylating its C-terminal glycine residue with ATP, thereafter linking this residue to the side chain of the catalytic cysteine, yielding a NEDD8-UBA3 thioester and free AMP. E1 finally transfers NEDD8 to the catalytic cysteine of UBE2M. Down-regulates steroid receptor activity. Necessary for cell cycle progression.
  • Tissue specificity

    Ubiquitously expressed.
  • Pathway

    Protein modification; protein neddylation.
  • Sequence similarities

    Belongs to the ubiquitin-activating E1 family. UBA3 subfamily.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab140421.

References

ab140421 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab140421.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up