Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MEGSEPVAAHQGEEASCSSWGTGSTNKNLPIMSTASVEIDDALYSRQRYV LGDTAMQKMAKSHVFLSGMGGLGLEIAKNLVLAGIKAVTIHDTEKCQAWD LGTNFFLSEDDVVNKRNRAEAVLKHIAELNPYVHVTSSSVPFNETTDLSF LDKYQCVVLTEMKLPLQKKINDFCRSQCPPIKFISADVHGIWSRLFCDFG DEFEVLDTTGEEPKEIFISNITQANPGIVTCLENHPHKLETGQFLTFREI NGMTGLNGSIQQITVISPFSFSIGDTTELEPYLHGGIAVQVKTPKTVFFE SLERQLKHPKCLIVDFSNPEAPLEIHTAMLALDQFQEKYSRKPNVGCQQD SEELLKLATSISETLEEKPDVNADIVHWLSWTAQGFLSPLAAAVGGVASQ EVLKAVTGKFSPLCQWLYLEAADIVESLGKPECEEFLPRGDRYDALRACI GDTLCQKLQNLNIFLVGCGAIGCEMLKNFALLGVGTSKEKGMITVTDPDL IEKSNLNRQFLFRPHHIQKPKSYTAADATLKINSQIKIDAHLNKVCPTTE TIYNDEFYTKQDVIITALDNVEARRYVDSRCLANLRPLLDSGTMGTKGHT EVIVPHLTESYNSHRDPPEEEIPFCTLKSFPAAIEHTIQWARDKFESSFS HKPSLFNKFWQTYSSAEEVLQKIQSGHSLEGCFQVIKLLSRRPRNWSQCV ELARLKFEKYFNHKALQLLHCFPLDIRLKDGSLFWQSPKRPPSPIKFDLN EPLHLSFLQNAAKLYATVYCIPFAEEDLSADALLNILSEVKIQEFKPSNK VVQTDETARKPDHVPISSEDERNAIFQLEKAILSNEATKSDLQMAVLSFE KDDDHNGHIDFITAASNLRAKMYSIEPADRFKTKRIAGKIIPAIATTTAT VSGLVALEMIKVTGGYPFEAYKNCFLNLAIPIVVFTETTEVRKTKIRNGI SFTIWDRWTVHGKEDFTLLDFINAVKEKYGIEPTMVVQGVKMLYVPVMPG HAKRLKLTMHKLVKPTTEKKYVDLTVSFAPDIDGDEDLPGPPVRYYFSHD TD
    • Molecular weight
      148 kDa including tags
    • Amino acids
      1 to 1052
    • Additional sequence information
      Proprietary tag.

Specifications

Our Abpromise guarantee covers the use of ab188675 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Typical enzyme concentration to support conjugation in vitro is 50-200 nM depending on conditions.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    >95% by SDS-PAGE .

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • E1-L2
    • FLJ10808
    • FLJ23367
    • Monocyte protein 4
    • MOP 4
    • MOP-4
    • MOP4
    • UBA 6
    • Uba6
    • UBA6 ubiquitin activating enzyme E1
    • UBA6_HUMAN
    • UBE1L2
    • Ubiquitin activating enzyme 6
    • Ubiquitin activating enzyme E1 like 2
    • Ubiquitin activating enzyme E1 like protein 2
    • Ubiquitin like modifier activating enzyme 6
    • Ubiquitin-activating enzyme 6
    • Ubiquitin-activating enzyme E1-like protein 2
    • Ubiquitin-like modifier-activating enzyme 6
    see all
  • Function
    Activates ubiquitin by first adenylating its C-terminal glycine residue with ATP, and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thioester and free AMP. Specific for ubiquitin, does not activate ubiquitin-like peptides. Differs from UBE1 in its specificity for substrate E2 charging. Does not charge cell cycle E2s, such as CDC34. Essential for embryonic development. Required for UBD/FAT10 conjugation. Isoform 2 may play a key role in ubiquitin system and may influence spermatogenesis and male fertility.
  • Tissue specificity
    Widely expressed. Isoform 2 is predominantly expressed in testis with higher expression in adult testis than in fetal testis.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the ubiquitin-activating E1 family.
  • Information by UniProt

References

ab188675 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab188675.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up