Recombinant Human Ubc13 + UbE2V2 protein (ab206000)

Description

  • Product name

    Recombinant Human Ubc13 + UbE2V2 protein
  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Amino Acid Sequence 1

    • Species

      Human
    • Sequence

      MAVSTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMI IGPPRTNYENRIYSLKVECGPKYPEAPPSVRFVTKINMNGINNSSGMVDA RSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN
    • Predicted molecular weight

      16 kDa
    • Amino acids

      1 to 145
    • Additional sequence information

      NM_003350.
    • Amino Acid Sequence 2

    • Species

      Human
    • Sequence

      MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGPQDSPFEGG TFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLGRICLDILKDKWSPALQ IRTVLLSIQALLSAPNPDDPLANDVAEQWKTNEAQAIETARAWTRLYAMN NI
    • Predicted molecular weight

      17 kDa
    • Amino acids

      1 to 152

Specifications

Our Abpromise guarantee covers the use of ab206000 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    Constituents: 0.24% Tris, 0.87% Sodium chloride, 0.02% Beta mercaptoethanol, 10% Glycerol

Images

  • SDS-PAGE analysis of ab206000 (5µg).

References

ab206000 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206000.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up