Description

  • Product name

    Recombinant Human UBC4 protein
  • Purity

    > 95 % SDS-PAGE.
    ab109971 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMALKRIHKELNDLARDPPAQCSAGPVGDDM FHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNINS NGSICLDILRSQWSPALTISKVLLSICSLLCDPNPDDPLVPEIARIYKTD REKYNRIAREWTQKYAM
    • Predicted molecular weight

      19 kDa including tags
    • Amino acids

      1 to 167
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109971 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as UBE2D2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 10% Glycerol, 0.058% Sodium chloride

General Info

  • Alternative names

    • E2(17)KB2
    • OTTHUMP00000223475
    • OTTHUMP00000223476
    • OTTHUMP00000223477
    • OTTHUMP00000223478
    • OTTHUMP00000224375
    • PUBC 1
    • PUBC1
    • UB2D2_HUMAN
    • UBC 4
    • UBC 4/5
    • UBC4
    • UBC4/5
    • UBC4/5 homolog yeast
    • UBCH 5B
    • UBCH5B
    • UBE2D2
    • Ubiquitin carrier protein
    • Ubiquitin carrier protein D2
    • Ubiquitin conjugating enzyme E2 17 kDa 2
    • Ubiquitin conjugating enzyme E2 D2
    • Ubiquitin conjugating enzyme E2D 2
    • Ubiquitin conjugating enzyme E2D 2 (homologous to yeast UBC4/5)
    • Ubiquitin conjugating enzyme E2D 2 (UBC4/5 homolog yeast)
    • Ubiquitin protein ligase D2
    • Ubiquitin-conjugating enzyme E2 D2
    • Ubiquitin-conjugating enzyme E2(17)KB 2
    • Ubiquitin-conjugating enzyme E2-17 kDa 2
    • Ubiquitin-protein ligase D2
    see all
  • Function

    Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-48'-linked polyubiquitination. Mediates the selective degradation of short-lived and abnormal proteins. Functions in the E6/E6-AP-induced ubiquitination of p53/TP53. Mediates ubiquitination of PEX5 and autoubiquitination of STUB1 and TRAF6. Involved in the signal-induced conjugation and subsequent degradation of NFKBIA, FBXW2-mediated GCM1 ubiquitination and degradation, MDM2-dependent degradation of p53/TP53 and the activation of MAVS in the mitochondria by DDX58/RIG-I in response to viral infection. Essential for viral activation of IRF3.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the ubiquitin-conjugating enzyme family.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab109971.

References

ab109971 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab109971.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up