Description

  • Product name

    Recombinant Human UBC6e protein
    See all UBC6e proteins and peptides
  • Purity

    = 80 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      METRYNLKSPAVKRLMKEAAELKDPTDHYHAQPLEDNLFEWHFTVRGPPD SDFDGGVYHGRIVLPPEYPMKPPSIILLTANGRFEVGKKICLSISGHHPE TWQPSWSIRTALLAIIGFMPTKGEGAIGSLDYTPEERRALAKKSQDFCCE GCGSAMKDVLLPLKSGSDSSQADQEAKELARQISFKAEVNSSGKTISESD LNHSFSLTDLQDDIPTTFQGATASTSYGLQNSSAASFHQPTQPVAKNTSM SPRQRRAQQQSQRRLSTSPDVIQGHQPRDNHT
    • Predicted molecular weight

      31 kDa including tags
    • Amino acids

      1 to 282
    • Additional sequence information

      NM_016021.2.

Specifications

Our Abpromise guarantee covers the use of ab206179 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    Constituents: 0.24% Tris, 0.87% Sodium chloride, 0.02% Beta mercaptoethanol, 10% Glycerol

General Info

  • Alternative names

    • CGI-76
    • HSPC153
    • HSPC205
    • HSU93243
    • HSUBC6e
    • MGC12555
    • NCUBE-1
    • NCUBE1
    • Non-canonical ubiquitin-conjugating enzyme 1
    • UB2J1_HUMAN
    • UBC6
    • UBC6E
    • Ubc6p
    • Ube2j1
    • Ubiquitin conjugating enzyme E2, J1 (UBC6 homolog, yeast)
    • Ubiquitin conjugating enzyme E2, J1, U
    • Ubiquitin-conjugating enzyme E2 J1
    • Yeast ubiquitin-conjugating enzyme UBC6 homolog E
    see all
  • Function

    Catalyzes the covalent attachment of ubiquitin to other proteins. Seems to function in the selective degradation of misfolded membrane proteins from the endoplasmic reticulum.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the ubiquitin-conjugating enzyme family.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • Coomassie-stained SDS-PAGE analysis of ab206179 (5µg).

References

ab206179 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206179.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up