Description

  • Product name

    Recombinant Human Ube2B protein
    See all Ube2B proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    assessed by densitometry
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSTPARRRLMRDFKRLQEDPPVGVSGAPSENNIMQWNAVIFGPEGTPFED GTFKLVIEFSEEYPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTY DVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRVSAIVEQSWN DS
    • Predicted molecular weight

      17 kDa including tags
    • Amino acids

      1 to 152
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151807 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.00
    Preservative: 1.02% Imidazole
    Constituents: 0.002% PMSF, 0.82% Sodium phosphate, 0.04% DTT, 25% Glycerol, 1.76% Sodium chloride

General Info

  • Alternative names

    • E2 17kDa
    • E2 protein
    • hHR6B
    • HR6B
    • RAD6 homolog B
    • RAD6B
    • UBC2
    • UBE2B
    • UBE2B_HUMAN
    • Ubiquitin carrier protein B
    • Ubiquitin conjugating enzyme E2 B
    • Ubiquitin conjugating enzyme E2B
    • Ubiquitin conjugating enzyme E2B (RAD6 homolog)
    • Ubiquitin protein ligase B
    • Ubiquitin-conjugating enzyme E2 17 kDa
    • Ubiquitin-conjugating enzyme E2 B
    • Ubiquitin-conjugating enzyme E2-17 kDa
    • Ubiquitin-protein ligase B
    see all
  • Function

    Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In association with the E3 enzyme BRE1 (RNF20 and/or RNF40), it plays a role in transcription regulation by catalyzing the monoubiquitination of histone H2B at 'Lys-120' to form H2BK120ub1. H2BK120ub1 gives a specific tag for epigenetic transcriptional activation, elongation by RNA polymerase II, telomeric silencing, and is also a prerequisite for H3K4me and H3K79me formation. In vitro catalyzes 'Lys-11'-, as well as 'Lys-48'- and 'Lys-63'-linked polyubiquitination. Required for postreplication repair of UV-damaged DNA. Associates to the E3 ligase RAD18 to form the UBE2B-RAD18 ubiquitin ligase complex involved in mono-ubiquitination of DNA-associated PCNA on 'Lys-164'. May be involved in neurite outgrowth.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the ubiquitin-conjugating enzyme family.
  • Cellular localization

    Cell membrane. Nucleus. In peripheral neurons, expressed both at the plasma membrane and in nuclei.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab151807 which was determined to be >90% pure by densitometry.

References

ab151807 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151807.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up