Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGI SAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLT PCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNT HAAELWKNPTAFKKYLQETYSKQVTSQEP
    • Molecular weight

      21 kDa including tags
    • Amino acids

      1 to 179
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab151891 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Purity

    > 95 % SDS-PAGE.
    assessed by densitometry
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.00
    Preservative: 1.02% Imidazole
    Constituents: 0.002% PMSF, 0.82% Sodium phosphate, 0.04% DTT, 25% Glycerol, 1.76% Sodium chloride

General Info

  • Alternative names

    • Cyclin selective ubiquitin carrier protein
    • dJ447F3.2
    • Mitotic specific ubiquitin conjugating enzyme
    • UB E2C
    • UBCH 10
    • UbcH10
    • UBE 2C
    • Ube2c
    • UBE2C_HUMAN
    • Ubiquitin carrier protein C
    • Ubiquitin carrier protein E2 C
    • Ubiquitin carrier protein E2C
    • Ubiquitin conjugating enzyme E2 C
    • Ubiquitin conjugating enzyme E2C
    • Ubiquitin protein ligase C
    • Ubiquitin-conjugating enzyme E2 C
    • Ubiquitin-protein ligase C
    see all
  • Function

    Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Acts as an essential factor of the anaphase promoting complex/cyclosome (APC/C), a cell cycle-regulated ubiquitin ligase that controls progression through mitosis. Acts by initiating 'Lys-11'-linked polyubiquitin chains on APC/C substrates, leading to the degradation of APC/C substrates by the proteasome and promoting mitotic exit.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the ubiquitin-conjugating enzyme family.
  • Post-translational
    modifications

    Autoubiquitinated by the APC/C complex, leading to its degradation by the proteasome. Its degradation plays a central role in APC/C regulation, allowing cyclin-A accumulation before S phase entry. APC/C substrates inhibit the autoubiquitination of UBE2C/UBCH10 but not its E2 function, hence APC/C remaining active until its substrates have been destroyed.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab151891 which was determined to be >95% pure by densitometry.

References

ab151891 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151891.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up