Description

  • Product name

    Recombinant Human UBE2E2 protein
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSTEAQRVDDSPSTSGGSSDGDQRESVQQEPEREQVQPKKKEGKISSKTA AKLSTSAKRIQ KELAEITLDPPPNCSAGPKGDNIYEWRSTILGPPGSV YEGGVFFLDITFSPDYPFKPPKV TFRTRIYHCNINSQGVICLDILKDN WSPALTISKVLLSICSLLTDCNPADPLVGSIATQY MTNRAEHDRMARQ WTKRYAT
    • Predicted molecular weight

      22 kDa
    • Amino acids

      1 to 201

Specifications

Our Abpromise guarantee covers the use of ab206155 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    Constituents: 0.24% Tris, 0.87% Sodium chloride, 10% Glycerol, 0.02% Beta mercaptoethanol

General Info

  • Alternative names

    • FLJ25157
    • UB2E2_HUMAN
    • UBC4/5 homolog yeast
    • UBCH 8
    • UbcH8
    • Ube2e2
    • Ubiquitin carrier protein E2
    • Ubiquitin conjugating enzyme E2 E2
    • Ubiquitin conjugating enzyme E2E 2
    • Ubiquitin conjugating enzyme E2E 2 (homologous to yeast UBC4/5)
    • Ubiquitin conjugating enzyme E2E 2 (UBC4/5 homolog yeast)
    • Ubiquitin protein ligase E2
    • Ubiquitin-conjugating enzyme E2 E2
    • Ubiquitin-protein ligase E2
    see all
  • Function

    Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-, as well as 'Lys-63'-linked polyubiquitination.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the ubiquitin-conjugating enzyme family.
  • Information by UniProt

Images

  • Coomassie stained SDS PAGE of ab206155 (5 μg)

References

ab206155 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206155.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up