Description

  • Product name

    Recombinant Human Ube2H protein
    See all Ube2H proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGV WKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYD LTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYAT EEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL
    • Predicted molecular weight

      48 kDa including tags
    • Amino acids

      1 to 183
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      AAH06277.

Specifications

Our Abpromise guarantee covers the use of ab220588 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 1.19% HEPES, 0.87% Sodium chloride, 5% Trehalose

    Lyophilized from 0.22 µm filtered solution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • E2 20K
    • GID complex subunit 3 UBC8 homolog
    • GID3
    • Ubc H2
    • UBC8
    • UBCH
    • UBCH 2
    • UBCH2
    • Ube2h
    • UBE2H_HUMAN
    • Ubiquitin carrier protein H
    • Ubiquitin conjugating enzyme E2 H
    • Ubiquitin conjugating enzyme E2H
    • Ubiquitin conjugating enzyme E2H (UBC8 homolog yeast)
    • Ubiquitin protein ligase H
    • Ubiquitin-conjugating enzyme E2 H
    • Ubiquitin-conjugating enzyme E2-20K
    • Ubiquitin-conjugating enzyme E2H (homologous to yeast UBC8)
    • Ubiquitin-protein ligase H
    see all
  • Function

    Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'- and 'Lys-48'-linked polyubiquitination. Capable, in vitro, to ubiquitinate histone H2A.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the ubiquitin-conjugating enzyme family.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab220588 stained overnight with Coomassie Blue.

    The protein migrates as 45 kDa under reducing conditions (SDS-PAGE).

References

ab220588 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220588.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up