Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      EKGPTLGSIETSDFTKRQLAVQSLAFNLKDKVFCELFPEVVEEIKQKQKA QDELSSRPQTLPLPDVVPDGETHLVQNGIQLLNGHAPGAVPNLAGLQQAN R
    • Molecular weight

      11 kDa
    • Amino acids

      124 to 224

Specifications

Our Abpromise guarantee covers the use of ab152004 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. Supplied as a 0.2 µM filtered solution.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.02% DTT, 0.88% Sodium chloride

General Info

  • Alternative names

    • NCUBE-2
    • NCUBE2
    • Non-canonical ubiquitin-conjugating enzyme 2
    • PRO2121
    • UB2J2_HUMAN
    • UBC6
    • UBC6 homolog
    • ube2j2
    • Ubiquitin conjugating enzyme 6
    • Ubiquitin-conjugating enzyme E2 J2
    • Yeast UBC6 homolog
    see all
  • Function

    Catalyzes the covalent attachment of ubiquitin to other proteins. Seems to function in the selective degradation of misfolded membrane proteins from the endoplasmic reticulum (ERAD).
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the ubiquitin-conjugating enzyme family.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt

References

ab152004 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152004.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up