Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKA FNLRISFPPEYPFKPPMIKFTTKIYHPNVDENGQICLPIISSENWKPCTK TCQVLEALNVLVNRPNIREPLRMDLADLLTQNPELFRKNAEEFTLRFGVD RPS
    • Molecular weight

      17 kDa including tags
    • Amino acids

      1 to 153
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab140809 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • Purity

    > 85 % Densitometry.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.00
    Preservative: 1.02% Imidazole
    Constituents: 0.002% PMSF, 0.7% Sodium phosphate, 0.004% DTT, 25% Glycerol, 1.76% Sodium chloride

General Info

  • Alternative names

    • MGC40331
    • Retinoic acid induced gene B protein
    • Retinoic acid-induced gene B protein
    • RIG B
    • RIG-B
    • UB2L6_HUMAN
    • UBCH 8
    • UbcH8
    • UBE2L6
    • Ubiquitin carrier protein
    • Ubiquitin carrier protein L6
    • Ubiquitin conjugating enzyme E2L 6
    • Ubiquitin protein ligase
    • Ubiquitin protein ligase L6
    • Ubiquitin-protein ligase L6
    • Ubiquitin/ISG15 conjugating enzyme E2 L6
    • Ubiquitin/ISG15-conjugating enzyme E2 L6
    see all
  • Function

    Catalyzes the covalent attachment of ubiquitin or ISG15 to other proteins. Functions in the E6/E6-AP-induced ubiquitination of p53/TP53.
  • Tissue specificity

    Present in natural killer cells (at protein level).
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the ubiquitin-conjugating enzyme family.
  • Post-translational
    modifications

    ISGylated.
  • Information by UniProt

Images

  • SDS PAGE analysis of ab140809 at ~17 kDa.

References

ab140809 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab140809.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up