Description

  • Product name

    Recombinant Human Ube2L6 protein
    See all Ube2L6 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MMASMRVVKELEDLQKKPPPYLRNLSSDDANVLVWHALLLPDQPPYHLKA FNLRISFPPEYPFKP PMIKFTTKIYHPNVDENGQICLPIISSENWKPCTKTCQVLEALNVLVNRP NIREPLRMDLADLLT QNPELFRKNAEEFTLRFGVDRPSLEHHHHHH
    • Predicted molecular weight

      18 kDa
    • Amino acids

      1 to 153
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab173041 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 1.19% HEPES, 0.58% Sodium chloride

    Supplied as a 0.2 µM filtered solution.

General Info

  • Alternative names

    • MGC40331
    • Retinoic acid induced gene B protein
    • Retinoic acid-induced gene B protein
    • RIG B
    • RIG-B
    • UB2L6_HUMAN
    • UBCH 8
    • UbcH8
    • UBE2L6
    • Ubiquitin carrier protein
    • Ubiquitin carrier protein L6
    • Ubiquitin conjugating enzyme E2L 6
    • Ubiquitin protein ligase
    • Ubiquitin protein ligase L6
    • Ubiquitin-protein ligase L6
    • Ubiquitin/ISG15 conjugating enzyme E2 L6
    • Ubiquitin/ISG15-conjugating enzyme E2 L6
    see all
  • Function

    Catalyzes the covalent attachment of ubiquitin or ISG15 to other proteins. Functions in the E6/E6-AP-induced ubiquitination of p53/TP53.
  • Tissue specificity

    Present in natural killer cells (at protein level).
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the ubiquitin-conjugating enzyme family.
  • Post-translational
    modifications

    ISGylated.
  • Information by UniProt

References

ab173041 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173041.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up