Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTSADVMWQDGSVECNIRSNDLFPVHHLDNNEFCPGDFVVDKRVQSCPDP AVYGVVQSGDHIGRTCMVKWFKLRPSGDDVELIGEEEDVSVYDIADHPDF RFRTTDIVIRIGNTEDGAPHKEDEPSVGQVARVDVSSKVEVVWADNSKTI ILPQHLYNIESEIEESDYDSVEGSTSGASSDEWEDDSDSWETDNGLVEDE HPKIEEPPIPPLEQPVAPEDKGVVISEEAATAAVQGAVAMAAPMAGLMEK AGKDGPPKSFRELKEAIKILESLKNMTVEQLLTGSPTSPTVEPEKPTREK KFLDDIKKLQENLKKTLDNVAIVEEEKMEAVPDVERKEDKPEGQSPVKAE WPSETPVLCQQCGGKPGVTFTSAKGEVFSVLEFAPSNHSFKKIEFQPPEA KKFFSTVRKEMALLATSLPEGIMVKTFEDRMDLFSALIKGPTRTPYEDGL YLFDIQLPNIYPAVPPHFCYLSQCSGRLNPNLYDNGKVCVSLLGTWIGKG TERWTSKSSLLQVLISIQGLILVNEPYYNEAGFDSDRGLQEGYENSRCYN EMALIRVVQSMTQLVRRPPEVFEQEIRQHFSTGGWRLVNRIESWLETHAL LEKAQALPNGVPKASSSPEPPAVAELSDSGQQEPEDGGPAPGEASQGSDS EGGAQGLASASRDHTDQTSETAPDASVPPSVKPKKRRKSYRSFLPEKSGY PDIGFPLFPLSKGFIKSIRGVLTQFRAALLEAGMPECTEDK
    • Amino acids
      1 to 741
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163749 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • E2 230K
    • EC=6.3.2.19
    • FLJ12878
    • KIAA1734
    • Likely Ortholog of Mouse Ubiquitin Conjugating Enzyme
    • RP23 193A16.5
    • UBE2O
    • UBE2O_HUMAN
    • Ubiquitin carrier protein O
    • Ubiquitin conjugating enzyme E2 O
    • Ubiquitin conjugating enzyme E2 of 230 kDa
    • ubiquitin conjugating enzyme E2O
    • Ubiquitin protein ligase O
    • Ubiquitin-conjugating enzyme E2 O
    • Ubiquitin-conjugating enzyme E2 of 230 kDa
    • Ubiquitin-conjugating enzyme E2-230K
    • Ubiquitin-protein ligase O
    see all
  • Function
    Catalyzes the covalent attachment of ubiquitin to other proteins.
  • Tissue specificity
    Predominantly expressed in skeletal muscle and heart.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the ubiquitin-conjugating enzyme family.
  • Information by UniProt

Images

  • ab163749 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163749 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163749.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up