Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MHGRAYLLLHRDFCDLKENNYKGITAKPVSEDMMEWEVEIEGLQNSVWQG LVFQLTIHFTSEYNYAPPVVKFITIPFHPNVDPHTGQPCIDFLDNPEKWN TNYTLSSILLALQVMLSNPVLENPVNLEAARILVKDESLYRTILRLFNRP LQMKDDSQELPKDPRKCIRPIKTTSFSDYYQTWSRIATSKATEYYRTPLL KVPNFIGQYYKWKKMDLQHQKEWNLK
    • Molecular weight

      53 kDa including tags
    • Amino acids

      1 to 226

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132838 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • RP4-636O23.1
    • UBE2U
    • UBE2U_HUMAN
    • Ubiquitin carrier protein U
    • Ubiquitin conjugating enzyme E2U (putative)
    • Ubiquitin-conjugating enzyme E2 U
    • Ubiquitin-protein ligase U
    see all
  • Function

    Catalyzes the covalent attachment of ubiquitin to other proteins.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the ubiquitin-conjugating enzyme family.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132838 stained with Coomassie Blue.

References

ab132838 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132838.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up