Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      PGEVQASYLKSQSKLSDEGRLEPRKFHCKGVKVPRNFRLLEELEEGQKGV GDGTVSWGL EDDEDMTLTRWTGMIIGPPRTIYENRIYSLKIECGPKYP EAPPFVRFVTKINMNGVNSSN GVVDPRAISVLAKWQNSYSIKVVLQEL RRLMMSKENMKLPQPPEGQCYSN
    • Molecular weight

      20 kDa including tags
    • Amino acids

      2 to 170
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab198472 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    50 μl reaction mix (4 mM ATP, 5 mM MgCl2, 1 mM DTT, UBE1 (0.5 μg), UEV1A or other E2, Biotin-Ubiquitin (0.5 μg) and Smurf2 (2 μg) in 50 mM Tris, pH 7.4) for 30 minutes at 37°C. Add to Streptavidin-coated plates for 30 minutes at 37°C. Incubate with anti-Smurf2, then HRP-labeled secondary antibody and chemiluminescent detection

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 0.71% Tris HCl, 0.72% Sodium chloride, 0.02% Potassium chloride, 10% Glycerol, 0.05% DTT

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • CIR1
    • CROC-1
    • CROC1
    • CROC1A
    • TRAF6-regulated IKK activator 1 beta Uev1A
    • UB2V1_HUMAN
    • UBE2V
    • UBE2V 1
    • UBE2V1
    • Ubiquitin conjugating enzyme E2 variant 1
    • Ubiquitin-conjugating enzyme E2 variant 1
    • UEV-1
    • UEV1
    see all
  • Function

    Has no ubiquitin ligase activity on its own. The UBE2V1-UBE2N heterodimer catalyzes the synthesis of non-canonical poly-ubiquitin chains that are linked through Lys-63. This type of poly-ubiquitination activates IKK and does not seem to involve protein degradation by the proteasome. Plays a role in the activation of NF-kappa-B mediated by IL1B, TNF, TRAF6 and TRAF2. Mediates transcriptional activation of target genes. Plays a role in the control of progress through the cell cycle and differentiation. Plays a role in the error-free DNA repair pathway and contributes to the survival of cells after DNA damage.
  • Tissue specificity

    Highly expressed in thyroid, pancreas, spinal cord, lymph node, trachea, adrenal gland, bone marrow and pancreas. Detected at low levels in heart, breast, placenta, brain, liver, kidney, stomach and lung.
  • Sequence similarities

    Belongs to the ubiquitin-conjugating enzyme family.
  • Cellular localization

    Nucleus. Excluded from the nucleolus.
  • Information by UniProt

Images

  • 4-20% SDS PAGE analysis of 1 μg ab198472 stained with Coomassie

  • Functional studies of ab198472

References

ab198472 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198472.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up