Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      IRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKDRLHLQ GQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENA
    • Amino acids
      136 to 225
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163930 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLJ13855
    • GC17P044341
    • HOYS7
    • Uba6 specific E2 conjugating enzyme 1
    • UBA6 specific enzyme E2
    • Uba6-specific E2 conjugating enzyme 1
    • UBE2Z
    • UBE2Z_HUMAN
    • Ubiquitin carrier protein Z
    • Ubiquitin conjugating enzyme E2 Z
    • Ubiquitin conjugating enzyme E2Z
    • Ubiquitin protein ligase Z
    • Ubiquitin-conjugating enzyme E2 Z
    • Ubiquitin-protein ligase Z
    • Use1
    see all
  • Function
    Catalyzes the covalent attachment of ubiquitin to other proteins (By similarity). Specific substrate for UBE1L2, not charged with ubiquitin by UBE1. May be involved in apoptosis regulation.
  • Tissue specificity
    Widely expressed. Highly in placenta, pancreas, spleen and testis.
  • Pathway
    Protein modification; protein ubiquitination.
  • Sequence similarities
    Belongs to the ubiquitin-conjugating enzyme family.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab163930 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163930 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163930.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up