Description

  • Product name

    Recombinant Human UBE2Z protein
    See all UBE2Z proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab173055 is greater than 95% pure, as determined by SEC-HPLC and reducing SDS-PAGE. It is supplied as a 0.2 µM filtered solution.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMSIYKEPPPGMFVVPDTVDMTKIHALITGP FDTPYEGGFFLFVFRCPPDYPIHPPRVKLMTTGNNTVRFNPNFYRNGKVC LSILGTWTGPAWSPAQSISSVLISIQSLMTENPYHNEPGFEQERHPGDSK NYNECIRHETIRVAVCDMMEGKCPCPEPLRGVMEKSFLEYYDFYEVACKD RLHLQGQTMQDPFGEKRGHFDYQSLLMRLGLIRQKVLERLHNENAEMDSD SSSSGTETDL HGSLRV
    • Predicted molecular weight

      30 kDa including tags
    • Amino acids

      1 to 246
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab173055 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 1.19% HEPES, 0.29% Sodium chloride

General Info

  • Alternative names

    • FLJ13855
    • GC17P044341
    • HOYS7
    • Uba6 specific E2 conjugating enzyme 1
    • UBA6 specific enzyme E2
    • Uba6-specific E2 conjugating enzyme 1
    • UBE2Z
    • UBE2Z_HUMAN
    • Ubiquitin carrier protein Z
    • Ubiquitin conjugating enzyme E2 Z
    • Ubiquitin conjugating enzyme E2Z
    • Ubiquitin protein ligase Z
    • Ubiquitin-conjugating enzyme E2 Z
    • Ubiquitin-protein ligase Z
    • Use1
    see all
  • Function

    Catalyzes the covalent attachment of ubiquitin to other proteins (By similarity). Specific substrate for UBE1L2, not charged with ubiquitin by UBE1. May be involved in apoptosis regulation.
  • Tissue specificity

    Widely expressed. Highly in placenta, pancreas, spleen and testis.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the ubiquitin-conjugating enzyme family.
  • Cellular localization

    Cytoplasm. Nucleus.
  • Information by UniProt

References

ab173055 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173055.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up