Description

  • Product name

    Recombinant human UBE3A protein
    See all UBE3A proteins and peptides
  • Biological activity

    Assay Conditions: 50 µl of reaction mixture 4 mM ATP, 5 mM MgCl2, 1 mM DTT, E1 (0.5 µg), E2 (2.8 µg), Biotinylated Ubiquitin (1 µg) in 50 mM Tris pH 7.4 was incubated for 30 min at 37°C. Transfer the reaction mixture to a streptavidin-coated plate and incubate for 30 min at 37°C. Add antibody against UBE3A, incubate 1 hr. Then, add secondary HRP-labeled antibody and incubate 30 min. Finally, add HRP chemiluminescent substrates and read luminescence.

  • Purity

    >= 81 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      KRAAAKHLIERYYHQLTEGCGNEACTNEFCASCPTFLRMDNNAAAIKALE LYKINAKLCDPHPSKKGASSAYLENSKGAPNNSCSEIKMNKKGARIDFKD VTYLTEEKVYEILELCREREDYSPLIRVIGRVFSSAEALVQSFRKVKQHT KEELKSLQAKDEDKDEDEKEKAACSAAAMEEDSEASSSRIGDSSQGDNNL QKLGPDDVSVDIDAIRRVYTRLLSNEKIETAFLNALVYLSPNVECDLTYH NVYSRDPNYLNLFIIVMENRNLHSPEYLEMALPLFCKAMSKLPLAAQGKL IRLWSKYNADQIRRMMETFQQLITYKVISNEFNSRNLVNDDDAIVAASKC LKMVYYANVVGGEVDTNHNEEDDEEPIPESSELTLQELLGEERRNKKGPR VDPLETELGVKTLDCRKPLIPFEEFINEPLNEVLEMDKDYTFFKVETENK FSFMTCPFILNAVTKNLGLYYDNRIRMYSERRITVLYSLVQGQQLNPYLR LKVRRDHIIDDALVRLEMIAMENPADLKKQLYVEFEGEQGVDEGGVSKEF FQLVVEEIFNPDIGMFTYDESTKLFWFNPSSFETEGQFTLIGIVLGLAIY NNCILDVHFPMVVYRKLMGKKGTFRDLGDSHPVLYQSLKDLLEYEGNVED DMMITFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDYILNK SVEKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETT EYDGGYTRDSVLIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLK MIIAKNGPDTERLPTSHTCFNVLLLPEYSSKEKLKERLLKAITYAKGFGM L
    • Predicted molecular weight

      100 kDa including tags
    • Amino acids

      2 to 852
    • Tags

      His-DDDDK tag N-Terminus
    • Additional sequence information

      Isoform I. NM_130838.

Specifications

Our Abpromise guarantee covers the use of ab198417 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 20% Glycerol, 0.05% DTT

    Contains 80 µg/ml DDDDK peptide.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • ANCR
    • Angelman syndrome
    • AS
    • CTCL tumor antigen se37 2
    • CTCL tumor antigen se37-2
    • E6 AP
    • E6AP
    • E6AP ubiquitin protein ligase
    • E6AP ubiquitin-protein ligase
    • EPVE6AP
    • FLJ26981
    • HECT-type ubiquitin transferase E3A
    • HPVE6A
    • Human papilloma virus E6 associated protein
    • Human papilloma virus E6 associated protein Angelman syndrome
    • Human papillomavirus E6-associated protein
    • NY REN 54 antigen
    • Oncogenic protein associated protein E6 AP
    • Oncogenic protein associated protein E6AP
    • Oncogenic protein-associated protein E6-AP
    • Renal carcinoma antigen NY REN 54
    • Renal carcinoma antigen NY-REN-54
    • UBE 3A
    • Ube3a
    • UBE3A protein
    • UBE3A_HUMAN
    • Ubiquitin protein ligase E3A
    • Ubiquitin-protein ligase E3A
    see all
  • Function

    E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and transfers it to its substrates. Several substrates have been identified including the RAD23A and RAD23B, MCM7 (which is involved in DNA replication), annexin A1, the PML tumor suppressor, and the cell cycle regulator CDKN1B. Catalyzes the high-risk human papilloma virus E6-mediated ubiquitination of p53/TP53, contributing to the neoplastic progression of cells infected by these viruses. Additionally, may function as a cellular quality control ubiquitin ligase by helping the degradation of the cytoplasmic misfolded proteins. Finally, UBE3A also promotes its own degradation in vivo. Plays an important role in the regulation of the circadian clock: involved in the ubiquitination of the core clock component ARNTL/BMAL1, leading to its proteasomal degradation (PubMed:24728990).
  • Pathway

    Protein modification; protein ubiquitination.
  • Involvement in disease

    Angelman syndrome
  • Sequence similarities

    Contains 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain.
  • Post-translational
    modifications

    Phosphorylation at Tyr-659 by ABL1 impairs E3 ligase activity and protects p53/TP53 from degradation in (HPV)-infected cells.
  • Cellular localization

    Nucleus. Cytoplasm.
  • Information by UniProt

Images

  • Activity assay using ab198417.

  • 4-20% SDS-PAGE analysis of 3 µg ab198417 with Coomassie staining.

References

ab198417 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198417.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up