Description

  • Product name

    Recombinant Human UBE3A protein
    See all UBE3A proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MEKLHQCYWKSGEPQSDDIEASRMKRAAAKHLIERYYHQLTEGCGNEACT NEFCASCPTF LRMDNNAAAIKALELYKINAKLCDPHPSKKGASSAYLE NSKGAPNNSCSEIKMNKKGARI DFKDVTYLTEEKVYEILELCREREDY SPLIRVIGRVFSSAEALVQSFRKVKQHTKEELKS LQAKDEDKDEDEKE KAACSAAAMEEDSEASSSRIGDSSQGDNNLQKLGPDDVSVDIDAIR RV YTRLLSNEKIETAFLNALVYLSPNVECDLTYHNVYSRDPNYLNLFIIVME NRNLHSPE YLEMALPLFCKAMSKLPLAAQGKLIRLWSKYNADQIRRMM ETFQQLITYKVISNEFNSRN LVNDDDAIVAASKCLKMVYYANVVGGEV DTNHNEEDDEEPIPESSELTLQELLGEERRNK KGPRVDPLETELGVKT LDCRKPLIPFEEFINEPLNEVLEMDKDYTFFKVETENKFSFMTC PFIL NAVTKNLGLYYDNRIRMYSERRITVLYSLVQGQQLNPYLRLKVRRDHIID DALVRL EMIAMENPADLKKQLYVEFEGEQGVDEGGVSKEFFQLVVEEI FNPDIGMFTYDESTKLFW FNPSSFETEGQFTLIGIVLGLAIYNNCILD VHFPMVVYRKLMGKKGTFRDLGDSHPVLYQ SLKDLLEYEGNVEDDMMI TFQISQTDLFGNPMMYDLKENGDKIPITNENRKEFVNLYSDY ILNKSV EKQFKAFRRGFHMVTNESPLKYLFRPEEIELLICGSRNLDFQALEETTEY DGGY TRDSVLIREFWEIVHSFTDEQKRLFLQFTTGTDRAPVGGLGKLK MIIAKNGPDTERLPTS HTCFNVLLLPEYSSKEKLKERLLKAITYAKGF GML
    • Predicted molecular weight

      101 kDa
    • Amino acids

      1 to 875

Specifications

Our Abpromise guarantee covers the use of ab206157 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    Constituents: 0.24% Tris, 10% Glycerol, 0.87% Sodium chloride, 0.02% Beta mercaptoethanol

General Info

  • Alternative names

    • ANCR
    • Angelman syndrome
    • AS
    • CTCL tumor antigen se37 2
    • CTCL tumor antigen se37-2
    • E6 AP
    • E6AP
    • E6AP ubiquitin protein ligase
    • E6AP ubiquitin-protein ligase
    • EPVE6AP
    • FLJ26981
    • HECT-type ubiquitin transferase E3A
    • HPVE6A
    • Human papilloma virus E6 associated protein
    • Human papilloma virus E6 associated protein Angelman syndrome
    • Human papillomavirus E6-associated protein
    • NY REN 54 antigen
    • Oncogenic protein associated protein E6 AP
    • Oncogenic protein associated protein E6AP
    • Oncogenic protein-associated protein E6-AP
    • Renal carcinoma antigen NY REN 54
    • Renal carcinoma antigen NY-REN-54
    • UBE 3A
    • Ube3a
    • UBE3A protein
    • UBE3A_HUMAN
    • Ubiquitin protein ligase E3A
    • Ubiquitin-protein ligase E3A
    see all
  • Function

    E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and transfers it to its substrates. Several substrates have been identified including the RAD23A and RAD23B, MCM7 (which is involved in DNA replication), annexin A1, the PML tumor suppressor, and the cell cycle regulator CDKN1B. Catalyzes the high-risk human papilloma virus E6-mediated ubiquitination of p53/TP53, contributing to the neoplastic progression of cells infected by these viruses. Additionally, may function as a cellular quality control ubiquitin ligase by helping the degradation of the cytoplasmic misfolded proteins. Finally, UBE3A also promotes its own degradation in vivo. Plays an important role in the regulation of the circadian clock: involved in the ubiquitination of the core clock component ARNTL/BMAL1, leading to its proteasomal degradation (PubMed:24728990).
  • Pathway

    Protein modification; protein ubiquitination.
  • Involvement in disease

    Angelman syndrome
  • Sequence similarities

    Contains 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain.
  • Post-translational
    modifications

    Phosphorylation at Tyr-659 by ABL1 impairs E3 ligase activity and protects p53/TP53 from degradation in (HPV)-infected cells.
  • Cellular localization

    Nucleus. Cytoplasm.
  • Information by UniProt

Images

  • Coomassie stained SDS PAGE of ab206157 (5 μg)

References

ab206157 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab206157.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up