Overview

  • Product name

    Recombinant Human UBF1 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      PPAATNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEI GSRWQRISQSQKEHYKKLAEEQQKQYKVHLDLWVKSLSPQDRAAYKEYIS
    • Amino acids

      551 to 650
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159770 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 90 kDa nucleolus organizer region autoantigen
    • Autoantigen NOR-90
    • NOR 90
    • Nucleolar transcription factor 1
    • UBF
    • UBF 1
    • UBF-1
    • UBF1_HUMAN
    • Ubtf
    • Upstream binding factor 1
    • upstream binding transcription factor, RNA polymerase I
    • Upstream-binding factor 1
    see all
  • Function

    Recognizes the ribosomal RNA gene promoter and activates transcription mediated by RNA polymerase I through cooperative interactions with the transcription factor SL1/TIF-IB complex. It binds specifically to the upstream control element.
  • Sequence similarities

    Contains 6 HMG box DNA-binding domains.
  • Post-translational
    modifications

    Phosphorylated and activated by PIK3CA.
  • Cellular localization

    Nucleus > nucleolus.
  • Information by UniProt

Images

  • ab159770 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159770 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159770.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up