Description

  • Product name

    Recombinant Human UBL5 protein
  • Purity

    > 90 % SDS-PAGE.
    ab109343 is purified using conventional chromatography.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMIEVVCNDRLGKKVRVKCNTDDTIGDLKKL IAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ
    • Predicted molecular weight

      11 kDa including tags
    • Amino acids

      1 to 73
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109343 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.0308% DTT, 0.316% Tris HCl, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • FLJ46917
    • HUB1
    • MGC131795
    • Ubiquitin like 5
    • Ubiquitin like protein 5
    • Ubiquitin-like protein 5
    • Ubl5
    • UBL5_HUMAN
    see all
  • Tissue specificity

    Ubiquitous. Highest level of expression in heart, skeletal muscle, kidney, liver, iris and lymphoblasts.
  • Sequence similarities

    Contains 1 ubiquitin-like domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab109343.

References

ab109343 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab109343.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up