Description

  • Product name

    Recombinant human UBPY/USP8 protein
    See all UBPY/USP8 proteins and peptides
  • Biological activity

    Specific Activity: 246 pmol/min/µg.

  • Purity

    >= 70 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      PAVASVPKELYLSSSLKDLNKKTEVKPEKISTKSYVHSALKIFKTAEECR LDRDEERAYVLYMKYVTVYNLIKKRPDFKQQQDYFHSILGPGNIKKAVEE AERLSESLKLRYEEAEVRKKLEEKDRQEEAQRLQQKRQETGREDGGTLAK GSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTDKNISLII MDARRMQDYQDSCILHSLSVPEEAISPGVTASWIEAHLPDDSKDTWKKRG NVEYVVLLDWFSSAKDLQIGTTLRSLKDALFKWESKTVLRNEPLVLEGGY ENWLLCYPQYTTNAKVTPPPRRQNEEVSISLDFTYPSLEESIPSKPAAQT PPASIEVDENIELISGQNERMGPLNISTPVEPVAASKSDVSPIIQPVPSI KNVPQIDRTKKPAVKLPEEHRIKSESTNHEQQSPQSGKVIPDRSTKPVVF SPTLMLTDEEKARIHAETALLMEKNKQEKELRERQQEEQKEKLRKEEQEQ KAKKKQEAEENEITEKQQKAKEEMEKKESEQAKKEDKETSAKRGKEITGV KRQSKSEHETSDAKKSVEDRGKRCPTPEIQKKSTGDVPHTSVTGDSGSGK PFKIKGQPESGILRTGTFREDTDDTERNKAQREPLTRARSEEMGRIVPGL PSGWAKFLDPITGTFRYYHSPTNTVHMYPPEMAPSSAPPSTPPTHKAKPQ IPAERDREPSKLKRSYSSPDITQAIQEEEKRKPTVTPTVNRENKPTCYPK AEISRLSASQIRNLNPVFGGSGPALTGLRNLGNTCYMNSILQCLCNAPHL ADYFNRNCYQDDINRSNLLGHKGEVAEEFGIIMKALWTGQYRYISPKDFK ITIGKINDQFAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHL DDFKAAEHAWQKHKQLNESIIVALFQGQFKSTVQCLTCHKKSRTFEAFMY LSLPLASTSKCTLQDCLRLFSKEEKLTDNNRFYCSHCRARRDSLKKIEIW KLPPVLLVHLKRFSYDGRWKQKLQTSVDFPLENLDLSQYVIGPKNNLKKY NLFSVSNHYGGLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAA YILFYTSLGPRVTDVAT
    • Predicted molecular weight

      128 kDa including tags
    • Amino acids

      2 to 1118
    • Tags

      DDDDK tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab198666 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.71% Tris HCl, 0.72% Sodium chloride, 0.02% Potassium chloride, 10% Glycerol, 0.05% DTT

    90 µg/mL FLAG peptide

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Deubiquitinating enzyme 8
    • FLJ34456
    • hUBPy
    • HumORF8
    • KIAA0055
    • MGC129718
    • SPG59
    • Ubiquitin carboxyl-terminal hydrolase 8
    • Ubiquitin isopeptidase Y
    • ubiquitin specific peptidase 8
    • Ubiquitin thioesterase 8
    • Ubiquitin-specific-processing protease 8
    • UBP8_HUMAN
    • UBPY
    • Usp8
    see all
  • Function

    Hydrolase that can remove conjugated ubiquitin from proteins and therefore plays an important regulatory role at the level of protein turnover by preventing degradation. Converts both 'Lys-48' an 'Lys-63'-linked ubiquitin chains. Catalytic activity is enhanced in the M phase. Involved in cell proliferation. Required to enter into S phase in response to serum stimulation. May regulate T-cell anergy mediated by RNF128 via the formation of a complex containing RNF128 and OTUB1. Probably regulates the stability of STAM2 and RASGRF1. Regulates endosomal ubiquitin dynamics, cargo sorting, membrane traffic at early endosomes, and maintenance of ESCRT-0 stability. The level of protein ubiquitination on endosomes is essential for maintaining the morphology of the organelle. Deubiquitinates EPS15 and controles tyrosine kinase stability. Removes conjugated ubiquitin from EGFR thus regulating EGFR degradation and downstream MAPK signaling. Involved in acrosome biogenesis through interaction with the spermatid ESCRT-0 complex and microtubules. Deubiquitinates BIRC6/bruce and KIF23/MKLP1.
  • Sequence similarities

    Belongs to the peptidase C19 family.
    Contains 1 MIT domain.
    Contains 1 rhodanese domain.
    Contains 1 USP domain.
  • Domain

    The MIT domain is required for endosomal localization, CHMP1B-binding, maintenance of ESCRT-0 stability and EGFR degradation.
    The rhodanese domain is sufficient for RNF41-binding.
  • Post-translational
    modifications

    Phosphorylation of Ser-718 is essential for interaction with YWHAE and for cytosol localization. Undergoes dephosphorylation at Ser-718 in the M phase. Tyrosine-phosphorylated in its N-terminal half in an EGFR-dependent manner.
    Ubiquitinated. Inactive form is mostly monoubiquitinated, but polyubiquitination happens too. Ubiquitination is increased in EGF-stimulated cells. Ubiquitination of active form is undetectable, suggesting a possibility that USP8 deubiquitinates itself, thereby regulating its own function.
  • Cellular localization

    Cytoplasm. Nucleus. Endosome membrane. Cell membrane.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE analysis of ab198666 (0.5 μg) with Coomassie staining.

  • Example of specific activity of ab198666.

References

ab198666 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198666.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up