Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREANLQAL IATGGDINAAIERLLGSQPS
    • Amino acids
      555 to 624
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162298 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bA431N15.1
    • CHAP 1
    • CHAP1
    • CHAP1/DSK2
    • Dsk 2
    • Dsk2
    • DSK2 homolog
    • hPLIC 2
    • hPLIC2
    • HRIHFB2157
    • LIC 2
    • LIC2
    • N4BP4
    • Nedd4 binding protein 4
    • PLIC 2
    • PLIC2
    • Protein linking IAP with cytoskeleton 2
    • RIHFB2157
    • Ubiquilin 2
    • Ubiquilin2
    • Ubiquitin like product Chap1/Dsk2
    • UBQLN 2
    see all
  • Relevance
    UBQLN2 (Ubiquilin 2) is a ubiquitin-like protein which contains an N-terminal ubiquitin-like (UBL) domain and a C-terminal ubiquitin-associated (UBA) domain. Ubiquilins interact with both proteasomes and ubiquitin ligases, and are thought to link the ubiquitination machinery to the proteasome to affect in vivo protein degradation. UBQLN2 increases the half-life of proteins destined to be degraded by the proteasome.
  • Cellular localization
    Cytoplasmic and Nuclear. Note=Where it colocalizes with the proteasome. Associated with fibers in mitotic cells.

Images

  • ab162298 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162298 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162298.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up